Scaffold Ga0187776_10102251

Overview

Basic Information

• Taxon OID: 3300017966
• Scaffold ID: Ga0187776_10102251
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1709
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas → Candidatus Dehalogenimonas etheniformans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Colombia: Department of Meta
• Coordinates
  • Lat. (^o): 4.2396
  • Long. (^o): -73.2024
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079367	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187776_101022513	F079367	AGGTGG	MKLPSLRGGVAGAKFRHKDDVAWWMTRYESLCTSEAEGVIRKAMAMLNDAVALHDDALDLVAELDHDISEAEDEIRRLGGAAFIEKLEPMIEE