Scaffold Ga0187776_10001270

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187776_10001270

Scaffold Ga0187776_10001270

Overview

Basic Information
Taxon OID	3300017966 Open in IMG/M
Scaffold ID	Ga0187776_10001270 Open in IMG/M
Source Dataset Name	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12526
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (95.24%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Colombia: Department of Meta
Coordinates	Lat. (^o)	4.2396	Long. (^o)	-73.2024	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057716	Metagenome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187776_1000127014	F057716	AGGGGG	MTRMIWVEGDEFTGWCCSACAWGITMPRLDSTVAALAFNRVAQEGFEEHDCAANPAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.