Scaffold Ga0190266_10018777

Overview

Basic Information

• Taxon OID: 3300017965
• Scaffold ID: Ga0190266_10018777
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1977
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 37.9013
  • Long. (^o): -109.5337

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054171	Metagenome / Metatranscriptome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0190266_100187772	F054171	GAG	MRAGFISSASTLTQPRMTWSKASGLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM