NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181607_10132543

Scaffold Ga0181607_10132543


Overview

Basic Information
Taxon OID3300017950 Open in IMG/M
Scaffold IDGa0181607_10132543 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1532
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027356Metagenome / Metatranscriptome195Y
F027832Metagenome / Metatranscriptome193N

Sequences

Protein IDFamilyRBSSequence
Ga0181607_101325432F027356GGAMNMMDTKITMKINGIHMNDRGEPVDRFDLEQAIMKAWRTTEDIKAFYTSAEHMDEDQVINALMGLEIFAEMRFNELWNTYEQCINNGVFDDSTKRGAEIARALDEATEGFGQEQI
Ga0181607_101325433F027832N/AMQMRMNASHAKGRYTMPRKKQLQIAIGPIEHVPSEKDRSHNELVCSICHCEFDIELEGGIDGYLGVLPVAMCAMCYSGLDEFFTQMHGCYDDEHDGYEDHDED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.