Scaffold Ga0187803_10075934

Overview

Basic Information

• Taxon OID: 3300017934
• Scaffold ID: Ga0187803_10075934
• Source Dataset Name: Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1322
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9061
  • Long. (^o): -76.1569
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030228	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187803_100759342	F030228	N/A	MRLFVTFPFTSAHDPMNCEYVAEVLRVDKLPKEKFGVAVNLKMTMNYPSGAPQNSNMLS