NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187806_1011258

Scaffold Ga0187806_1011258


Overview

Basic Information
Taxon OID3300017928 Open in IMG/M
Scaffold IDGa0187806_1011258 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2512
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis algeriensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F013663Metagenome / Metatranscriptome269Y
F014996Metagenome / Metatranscriptome258Y

Sequences

Protein IDFamilyRBSSequence
Ga0187806_10112582F013663N/AMTARPDRDGAEQLGLLGTAWEEAAQHWQDEVARQFDADHWTPLAQRSRAYLEALGTLLDVLETAERDTEF
Ga0187806_10112583F014996GGAVTKGGSGGTNIGYWGTNRVHADIDALKGFHEALVRFRYAQRGVAERGGDQIEMTRASLAAKASRWQSRLEQCHAELDACRAGGGEEAADCSAYVRAVEQTGERLEHIRRWQQRVDIEASEFGGTAGAYLDLLDSDLPRAESQLLAIITSLEAARRVPAAET
Ga0187806_10112584F001698AGGAGMSGVINDIDALAEFRTHLMQFNRDLAENFATIRGYWRELGEVWRDDMYRLFGEALDEVTPGITVYLAATEGHEAHLAALIERLRSYLETGLGAGAGTSRTETDRGKPT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.