Scaffold Ga0189787_11591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0189787_11591

Scaffold Ga0189787_11591

Overview

Basic Information
Taxon OID	3300017828 Open in IMG/M
Scaffold ID	Ga0189787_11591 Open in IMG/M
Source Dataset Name	Saline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	GATC-Biotech AG, Konstanz, Germany
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1449
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses

Source Dataset Sampling Location
Location Name	village of Ngallou, Senegal
Coordinates	Lat. (^o)	14.0491	Long. (^o)	-16.7624	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079661	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0189787_115912	F079661	N/A	MSDTTTIQIPTDLRKRLKDERLPHESNYGDTIERLLDDSTGGQLWTEQEIKDLIDRRISQAQRH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.