NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0189787_10536

Scaffold Ga0189787_10536


Overview

Basic Information
Taxon OID3300017828 Open in IMG/M
Scaffold IDGa0189787_10536 Open in IMG/M
Source Dataset NameSaline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3549
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → Halorubrum aethiopicum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses

Source Dataset Sampling Location
Location Namevillage of Ngallou, Senegal
CoordinatesLat. (o)14.0491Long. (o)-16.7624Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098766Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0189787_105365F098766N/ACGGEADGAHHVKVEVERIPPEEPPKTYYFHHTCFENSQSWERGL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.