Scaffold Ga0189786_10277

Overview

Basic Information

• Taxon OID: 3300017825
• Scaffold ID: Ga0189786_10277
• Source Dataset Name: Saline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P7
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: GATC-Biotech AG, Konstanz, Germany
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2997
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses

Source Dataset Sampling Location

• Location Name: village of Ngallou, Senegal
• Coordinates
  • Lat. (^o): 14.0491
  • Long. (^o): -16.7624

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096726	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0189786_102776	F096726	AGGAG	MTRDDWIDPTNTEASIREHVERLARGDRLDVDTPTGTEQIERRGPEWRLTHLGTGGGWCWAERMDTRQLVDYLTQWRSREGFDPITVRFVEDGGEQ