Scaffold Ga0182792_1002333

Overview

Basic Information

• Taxon OID: 3300017817
• Scaffold ID: Ga0182792_1002333
• Source Dataset Name: Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - Passage2 37B (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 13533
• Total Scaffold Genes: 21
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Comparative Metagneomics Of Mesophilic And Thermophilic Cellulose-Adapted Consortia

Source Dataset Sampling Location

• Location Name: Emeryville, CA
• Coordinates
  • Lat. (^o): 37.840898
  • Long. (^o): -122.289614

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017885	Metagenome / Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182792_100233313	F017885	GAGG	MANPNADVAGFQCPKCGQELEQTIGQLKSSEHMICSGCGIGINIDTNRLANLADELQKATAKVPPEITVKFYR