Scaffold Ga0188954_11031

Overview

Basic Information

• Taxon OID: 3300017815
• Scaffold ID: Ga0188954_11031
• Source Dataset Name: Saline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: GATC-Biotech AG, Konstanz, Germany
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2253
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses

Source Dataset Sampling Location

• Location Name: village of Ngallou, Senegal
• Coordinates
  • Lat. (^o): 14.0491
  • Long. (^o): -16.7624

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049200	Metagenome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188954_110314	F049200	N/A	MPDLTIGQRLALPYESDDTSISVAAEITGLGLPAVRVRTEDGETYIRHARKVTKWTNDRSHD