Scaffold Ga0188953_10349

Overview

Basic Information

• Taxon OID: 3300017813
• Scaffold ID: Ga0188953_10349
• Source Dataset Name: Saline water viral communities from Saloum River inverse estuary, Senegal ? P2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: GATC-Biotech AG, Konstanz, Germany
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5986
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses

Source Dataset Sampling Location

• Location Name: Saloum River, Senegal
• Coordinates
  • Lat. (^o): 14.0536
  • Long. (^o): -16.2885
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051561	Metagenome / Metatranscriptome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0188953_103494	F051561	GGAG	MSKDFDEEFDLLKALRESQALEMVEETENGWSTKVVPCELSQAAAKEIVQLRQQVNELRNQLNKKTVD