NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0169931_10038267

Scaffold Ga0169931_10038267


Overview

Basic Information
Taxon OID3300017788 Open in IMG/M
Scaffold IDGa0169931_10038267 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5458
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameRwanda: Western Province
CoordinatesLat. (o)-1.78Long. (o)29.2Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F011394Metagenome / Metatranscriptome291Y
F013878Metagenome / Metatranscriptome267Y
F017101Metagenome / Metatranscriptome242Y

Sequences

Protein IDFamilyRBSSequence
Ga0169931_1003826712F017101N/AMARDLTVLEGIVQDVAIALFQKWANAIPEDQRTEEQMGALSQNAAESTYFVVQMFMDRFNQAAEELKDK
Ga0169931_100382672F013878AGGAMLNLTQQGVEIFIRRAKNIQPFWSNYDLVIWKKDPSGFTNVKGMFKNESWGIAERIPVDNQGIWKLNSKYVRYFR
Ga0169931_100382674F011394GAGGMPSNLYDNSVYKYGINQWTGEPNKPVFYSKEMALKIRGLQKPIHTLQMDIIKYPEFLAIRLYEDNFKQYDGSIKMRVIDYIEMVKKIIESFGVRCELEGAPGERVLRNN
Ga0169931_100382676F000671GAGGMTEKILCYSCSKTKNKLNAKRSNLLPINLLMCESCINSRFEPRWVVILSGRQNGMEHVRDFVLKKRYIGNEISASELMV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.