Scaffold Ga0181355_1194019

Overview

Basic Information

• Taxon OID: 3300017785
• Scaffold ID: Ga0181355_1194019
• Source Dataset Name: Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 801
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 43.1881
  • Long. (^o): -86.344
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017996	Metagenome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181355_11940193	F017996	N/A	VGRSLTRWLIPLPAILFSIWPTTVQAEPIPGLNTTYYTIDEIPPVQSTSEYPVCGSEVENNINRSYDGEPYEDCTGDLFMVHMTGYITIPVHNTIEFMLAHDDGGE