Scaffold Ga0181346_1000705

Overview

Basic Information

• Taxon OID: 3300017780
• Scaffold ID: Ga0181346_1000705
• Source Dataset Name: Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 14737
• Total Scaffold Genes: 25
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 18 (72.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 43.1881
  • Long. (^o): -86.344
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034929	Metagenome	173	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0181346_100070516	F034929	N/A	MGVVLAMDQNDAEPPMIPTWGYVALRSKDKKTMVQVFTDITTGLIVYTQVCQRAESWHSWGPPTEVERVD