NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181432_1084816

Scaffold Ga0181432_1084816


Overview

Basic Information
Taxon OID3300017775 Open in IMG/M
Scaffold IDGa0181432_1084816 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)929
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003515Metagenome / Metatranscriptome482Y
F050302Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0181432_10848161F050302GAGGMMNVDSRVITLALFLIAQSVGAIWWASGLSSEVNRLSGLVDKSDQFQTEIQRAVSGLDVLNFKVEELW
Ga0181432_10848162F003515AGGMFARLLTILTLLVTSSALAGPPEGMVKQMIPFPAMCLPATVEKHHFATLMGALIDDYGVHISMTFSASPFQSQRVAIIENPDTGLAGVLMITDEQTCIAFSGEDRQEFIRPPDHPVGAENEAPKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.