NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181432_1002203

Scaffold Ga0181432_1002203


Overview

Basic Information
Taxon OID3300017775 Open in IMG/M
Scaffold IDGa0181432_1002203 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4310
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007837Metagenome / Metatranscriptome344Y
F013596Metagenome / Metatranscriptome270Y
F016759Metagenome / Metatranscriptome245Y
F094574Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0181432_10022032F016759GAGMSMEPIQRQMTNPAIGAIGTPALLQDNITLLSFIQLNIPNTILDMYNSPDPVAAADFYQYELQKNSISTGRNFFSTAMSTASAGRAAVGPIRLASGQLQMQGTPVGAAAPINDQNIVIKFSNGF
Ga0181432_10022033F007837N/AVIDLKTTVNPTIVNYPASYQSLAQSILIDNQDAANAVTVRLNRQTNTITIPGGGFRTMNDAWMEQIDLTGPSTNTQLTAQVSPLTQISPYGGGVTN
Ga0181432_10022037F013596N/AMEAFAQSLTILSIVVSMSVCAVLIARIYRKNAALDPKITHKLRKQHEEYTQELERKNRSLQNKLNSMQKGPIVSDNDDLDSVLPELVGQLDGVLPKWATKFLKSNPDIINSVIEYAKSNPDKAREIIGKFVKVGPKAQSPSDATLQGL
Ga0181432_10022038F094574N/AMSIMDTKLRSFNISNNKMYERFKQIQLERGKNASLRLNELIEKEVKEADPQFKELTAIRSKDAPDIIIPNPFLMDQFHSIPKWIEYMQTLTKTEHGDLYNHLLALKLVTHEFEDYRLD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.