Scaffold Ga0181358_1173594

Overview

Basic Information

• Taxon OID: 3300017774
• Scaffold ID: Ga0181358_1173594
• Source Dataset Name: Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 721
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033010	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181358_11735941	F033010	N/A	PDCLLAFPHGLFVMVELKVVKRGRKVNLSPHQVAFQIKHADLRCPTYILVQYHPPGTAHASKSELLLYAGEQAIDLVNLGIDTRPMARWPWTGIPWAELRKFLVTA