NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181410_1205569

Scaffold Ga0181410_1205569


Overview

Basic Information
Taxon OID3300017763 Open in IMG/M
Scaffold IDGa0181410_1205569 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)538
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003679Metagenome / Metatranscriptome474Y
F021181Metagenome / Metatranscriptome220Y
F068133Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0181410_12055691F003679GAGMFRIILKNKFKERKIDLSIVSRVMYHQPFTGSIQLEHITWWKRYWIRPILLEILYPKKGWITLVKVFRDGKPSIRVITKLASSGKRELS
Ga0181410_12055692F068133AGGMMQLAIDVFIDMFKSKEIYIIIGSAIVVWIILEWNDV
Ga0181410_12055693F021181N/AIESMRTLILISLLAGFVLAFLGVIIMFHSGEVWLGLGISLVGFYAVIRGTQRDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.