Scaffold Ga0181344_1006941

Overview

Basic Information

• Taxon OID: 3300017754
• Scaffold ID: Ga0181344_1006941
• Source Dataset Name: Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3744
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 43.2382
  • Long. (^o): -86.2805
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031756	Metagenome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181344_10069411	F031756	AGG	MDVLIPSIEENVPLPKNAQEAFPDLTPTEELNMRASVVALMSDLTGQPISPTQENAAEAKALAKEMLTNPLVRPDFSKYPNETLAMLAGMVAQMNVSVVDELAELKTYVVNHLVHSVEASKDVKTKITALRALGEVDGVDAFKKRTEVTHKIQTMEEVESELLELLDE