Scaffold Ga0181369_1040153

Overview

Basic Information

• Taxon OID: 3300017708
• Scaffold ID: Ga0181369_1040153
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1074
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Subarctic Pacific Ocean
• Coordinates
  • Lat. (^o): -20.099
  • Long. (^o): -70.892
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013482	Metagenome / Metatranscriptome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181369_10401535	F013482	N/A	MTNKDITIKNLKDRQKEINEEIEYKNTQSLSEELYEIKDTLKKLGVNENDN