NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182739_1206348

Scaffold Ga0182739_1206348


Overview

Basic Information
Taxon OID3300017655 Open in IMG/M
Scaffold IDGa0182739_1206348 Open in IMG/M
Source Dataset NameEnriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig BY (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)775
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location NameUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036409Metagenome / Metatranscriptome170N

Sequences

Protein IDFamilyRBSSequence
Ga0182739_12063481F036409N/AGKFHTLLFVHYDPETKKWKGPVVEAPFNDWNIDGGCPNFDAAGNIMIWSAGYDRGPDVITGGESGAGGVYDLYWLPTSEVIDYYKKAAGIG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.