NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182747_1000660

Scaffold Ga0182747_1000660


Overview

Basic Information
Taxon OID3300017560 Open in IMG/M
Scaffold IDGa0182747_1000660 Open in IMG/M
Source Dataset NameEnriched backyard soil microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C BE-Lig BY (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30986
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (54.84%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location NameUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011177Metagenome / Metatranscriptome294Y
F033108Metagenome / Metatranscriptome178Y

Sequences

Protein IDFamilyRBSSequence
Ga0182747_100066022F011177GGAGGMSEYLEDGTEILRPAEAAGRLGVRTRVVIEAMYYRRLPRVRLSDGLLGIPAPALEGFEAEPVQ
Ga0182747_100066023F033108N/AVSEFDDPVPPAILLDLDEVFRVLEALEGSLVVILDHGLAPGLLDELRTVIAMLHHRLGFDQGGWNV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.