Scaffold Ga0180217_1164836

Overview

Basic Information

• Taxon OID: 3300017540
• Scaffold ID: Ga0180217_1164836
• Source Dataset Name: Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C BE-Lig OP (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 613
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Emeryville, California
• Coordinates
  • Lat. (^o): 37.83
  • Long. (^o): -122.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019412	Metagenome / Metatranscriptome	230	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180217_11648361	F019412	N/A	LRRWIRELGRHHLLHLDAMQILVLVLCTKGRSLRQAIADDARLESFGLQVTKETQPGRAPGWLKLHGTDRTRGALNIEWDSESSLLRARVITRGTRKPSPIVGEFVNYLLARFSSRIVSITTAFR