Scaffold Ga0186377_1020570

Overview

Basic Information

• Taxon OID: 3300017373
• Scaffold ID: Ga0186377_1020570
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in L1 medium with seawater, 22 C, 33 psu salinity and 574 ?mol photons light - Brandtodinium nutricula RCC 3387 (MMETSP1462)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1017
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Perkinsozoa → Perkinsea → Perkinsida → Perkinsidae → Perkinsus → Perkinsus marinus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 43.683333
  • Long. (^o): 7.316667
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062433	Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186377_10205701	F062433	N/A	SGALMTATPTTTAVVASAPTLRSRASLGGGGSRQGLRAASPVVSSTVNKSSLLAGSSLGQLITRVTTTMHDREIEIRKQQAEHRETEELLGRSKEELQQLVSVVSQLHDLQQSANEVLPDVLQLGPERPRITPKPPFFWQPSPDYAGEFEVSGECGDIVTKVKDFEDQGWVIPVGGAWRLNKGGVYRWTIRIEKKCPSRPQLQLGIHGANHSQPWRLVTTSRCSWSRDDEPWQDRPGGDRLIDEGSYVHVEVDLRGIHSKGGTFSLAINDEPFEQFFDDVPLNSPYPLIPVVSMGGDQSRVRLCPNY