Scaffold Ga0186518_1040630

Overview

Basic Information

• Taxon OID: 3300017371
• Scaffold ID: Ga0186518_1040630
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in K/2 medium, 20 C, 35 psu salinity and 555 ?mol photons light - Pelagodinium beii RCC 1491 (MMETSP1338)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 501
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001028	Metagenome / Metatranscriptome	801	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186518_10406301	F001028	N/A	MPEGKMEISDAAKSGDGSIKNVGIKVNGKFKSPVNNQCFDTQEALDLHLKYLHDPRKASAVEE