Scaffold Ga0186694_1024981

Overview

Basic Information

• Taxon OID: 3300017361
• Scaffold ID: Ga0186694_1024981
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from Gulf of Mexico in L1 medium, 22 C, 32 psu salinity and 312 ?mol photons light - Scrippsiella trochoidea CCMP 3099 (MMETSP0272)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1247
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.3122
  • Long. (^o): -82.601

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073576	Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186694_10249811	F073576	N/A	DRVRVQGGKNFDKFHGGMEGTIVQNNPDCRNILVQFDDVATSGPEPITVAYKNLEFAPNRGGYRAGNAPAAPSQPSTQAPKEPQGPLLDEHGAFRTRQLVQLCGLQSAAAQELNGKFGRLRKFDPNADRWEVDVRNGLGIKRLKEDNMTAPPKPQVPDGLTVAELKERGNKAFQSQEYEEAIACYSACLDLLEEGEPKPAEAEDPKYIAVLFSNRAQVYITLCREVHGEEKAISKEARGYAMKANMDSARAIELDPTFGKAYYRRGCAVLGMAPSASRSKEAIFCLETALSGRASGGKDGIVLPNAMRHEVSNLLDYAKRRLDACVEAAVPDVEQCRENCRQQ