Basic Information | |
---|---|
Taxon OID | 3300017353 Open in IMG/M |
Scaffold ID | Ga0186692_1045085 Open in IMG/M |
Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from Gulf of Mexico in L1 medium, 22 C, 32 psu salinity and 684 ?mol photons light - Scrippsiella trochoidea CCMP 3099 (MMETSP0270) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 809 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium catenella | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 27.3122 | Long. (o) | -82.601 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033310 | Metatranscriptome | 177 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186692_10450851 | F033310 | N/A | VVHPHQDVRETRMPRMYLFPFEELLRVRLHPDPGVAISFQEEILLDGKREEEMVVQIARRDMPKGEEVFFWPGKLSNSEMVVRHGMKFDKNPVGIGRNITQPPNWAEAKGSKIRREYDKYNCSSLESFELRFSPLGSPSKTFVRCYRISWFLTNGWYSPALQNRRRDLDKWPPPKKYGKDDWLSWTQADQEVNRVILEYCRDMRARLKDSIDAALAKDFRRSKDPVDKLLWQVRGEESKTFKECMKQAQSIVV |
⦗Top⦘ |