Scaffold Ga0186678_1023264

Overview

Basic Information

• Taxon OID: 3300017345
• Scaffold ID: Ga0186678_1023264
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from North Sea in half strength K medium with seawater and selenite, 15 C, 32 psu salinity and 294 ?mol photons light - Azadinium spinosum 3D9 (MMETSP1037_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1066
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Sea
• Coordinates
  • Lat. (^o): 57.0525
  • Long. (^o): 2.50056

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021304	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186678_10232641	F021304	N/A	HGRPQPGAAQALQVPPLRPLRCRGRGVFASAKAVVAAAVWPLLMGFLAGQVPLVVAEPCQEHPKDYTIVQFTQEDCRCCFDLDEFIQDNDYVYVLFYSTKGRLNIDINAKFEQLAMEWKFGSRIHFGRIDTDKDREMAKKWVEPGMVPTNVMYKFGRPVEVKPKDFENIRDRYQGSPEGQKWMLTKYMGEDADGSNLHYATPLLTAKKHAKFVKSNEISIVGFFKRDNDLHHKIFCESIWKLHQDIDRDDIGAGVAAVTTQSVAKKEQVQVPSIVVYLDGKAVEEEGAFLAAKWTVKAVTEFMRQFLPLSDQDDAEALGDPEAGDAMGDKEEL