Scaffold Ga0186677_1040046

Overview

Basic Information

• Taxon OID: 3300017343
• Scaffold ID: Ga0186677_1040046
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from North Sea in half strength K medium with seawater and selenite, 20 C, 26 psu salinity and 298 ?mol photons light - Azadinium spinosum 3D9 (MMETSP1038_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 689
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Sea
• Coordinates
  • Lat. (^o): 57.0525
  • Long. (^o): 2.50056

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078185	Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186677_10400461	F078185	AGG	MGGHTRLWHPKWFSRYLWGTIASIQLTGFVADQQYGINRSKNPEILWPWWHEIMRKKEEGKIPKDMPGYMLCKYRNEPEERWTGEREEQFGEFMGAMNDEEE