Scaffold Ga0186492_1023244

Overview

Basic Information

• Taxon OID: 3300017338
• Scaffold ID: Ga0186492_1023244
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Baffin Bay in L1 medium with seawater, 2 C, 33 psu salinity and 548 ?mol photons light - Heterocapsa arctica CCMP 445 (MMETSP1441)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 622
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: Baffin Bay
• Coordinates
  • Lat. (^o): 76.25
  • Long. (^o): 82.55
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026799	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186492_10232441	F026799	N/A	MGAHGSCCSCEDETSGSYIDDGKKPRRESRKRQANEFTVIIDRRSGEGLGIDASPEKTGTLEIKSITAGGLVDRWNQSLSDDSREIVRPGMRVIEVNGRYNSAMQLIAACRETEVLHITIMPDA