Scaffold Ga0186492_1002017

Overview

Basic Information

• Taxon OID: 3300017338
• Scaffold ID: Ga0186492_1002017
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Baffin Bay in L1 medium with seawater, 2 C, 33 psu salinity and 548 ?mol photons light - Heterocapsa arctica CCMP 445 (MMETSP1441)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2215
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: Baffin Bay
• Coordinates
  • Lat. (^o): 76.25
  • Long. (^o): 82.55
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085123	Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186492_10020172	F085123	AGG	MFKALEKSPTISSDSLIQVYECHLVLEGEYKDDYKRYRIDRDLVEALEDHYKDSRKDERRCSEKQRNDVASVLKSLVDGSVHVNHRTSTCLLVDVAALRKRSSTDGFIHVDLDSNVTTVRSLDTDEMTSASLIVEGSVALRRRILTKAGLRLVTVRESEWRDLDDSKEKRRHLRSLLSNLGDVLQ