Scaffold Ga0186517_122331

Overview

Basic Information

• Taxon OID: 3300017324
• Scaffold ID: Ga0186517_122331
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in L1 medium with seawater, 14 C, 33 psu salinity and 537 ?mol photons light - Gonyaulax spinifera CCMP 409 (MMETSP1439)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 574
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 43.8441
  • Long. (^o): -69.6413
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016665	Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186517_1223311	F016665	GAG	MESMKRSPTFLVGTDKQRGILDEFQRREQHFTEEYQKNKPLCFSARAFQQTHPAKVRMGYKDADATLTSPMLLGVCDGVSQLEEFNMDPSLLPNELLRTCEELAMMQLMPDMPVSPQDAYRGPISLLKEAYEETESYGSTTVLLAALDNGTRIHGKLHPMIAVLS