Scaffold Ga0186484_117701

Overview

Basic Information

• Taxon OID: 3300017318
• Scaffold ID: Ga0186484_117701
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Baffin Bay in ProV 50 medium with seawater and antibiotics, 6 C, 32 psu salinity and 528 ?mol photons light - unclassified eukaryote CCMP 2293 (MMETSP0987)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 747
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: Baffin Bay
• Coordinates
  • Lat. (^o): 78.5922
  • Long. (^o): -74.4922

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021541	Metagenome / Metatranscriptome	218	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186484_1177012	F021541	AGG	MLFACSSLTEPPFLLQMFSTLYGQTAAALYAKAAGQNAQARQLYNASADTYYKANDAAAYDDWVRARNHWDYFYNRS