Basic Information | |
---|---|
Taxon OID | 3300017318 Open in IMG/M |
Scaffold ID | Ga0186484_116236 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Baffin Bay in ProV 50 medium with seawater and antibiotics, 6 C, 32 psu salinity and 528 ?mol photons light - unclassified eukaryote CCMP 2293 (MMETSP0987) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 806 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Cryptophyceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: Baffin Bay | |||||||
Coordinates | Lat. (o) | 78.5922 | Long. (o) | -74.4922 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101267 | Metagenome / Metatranscriptome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186484_1162362 | F101267 | N/A | QAPSSRQVSRRDYRHIKMGCCSSRAPGSHEWQAQVPGSFKANPIPTVNKKQAIPADFFQKCYMKGYLRTLPKKQRIWCMIHENNFYFMDSAEDTEPRKFFCFDGCLVNLKGKELEIQTAELMGGSVPRATYKFVAEGPDEEKALEWYEASLKASSRRN |
⦗Top⦘ |