Scaffold Ga0186630_1042524

Overview

Basic Information

• Taxon OID: 3300017303
• Scaffold ID: Ga0186630_1042524
• Source Dataset Name: Metatranscriptome of freshwater ice eukaryotic communities from Messo in MWC medium with 4.55 nmol/L selenium, 3 C, 0 psu salinity and 680 ?mol photons light - Scrippsiella hangoei SHHI-4 (MMETSP0367)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 602
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Russia: Messo
• Coordinates
  • Lat. (^o): 68.46306
  • Long. (^o): 78.22333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086592	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186630_10425241	F086592	N/A	MSEGLEDFAAVRKIIEDKLHQEFYNVPTKDLPPRMQPRQLPNLQDAAKIDWDDWKEWEWLKPGWKGIKMHSQCVINSDGSAEVRSVWK