Scaffold Ga0186688_1022775

Overview

Basic Information

• Taxon OID: 3300017286
• Scaffold ID: Ga0186688_1022775
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from Indian River Bay, Delaware, USA in L1 medium, 22 C, 34 psu salinity and 695 ?mol photons light - Prorocentrum minimum CCMP 2233 (MMETSP0267)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 962
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: USA: Indian River Bay, Delaware
• Coordinates
  • Lat. (^o): 38.59
  • Long. (^o): -75.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028077	Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186688_10227751	F028077	N/A	LPPGTDIMEFCRALAESGADFAEQFDRNSATFHGGLTTEVPLGGARVPESMGGESAADWRSLPDAPIAIDDDFGPEYHAAVAAHKRLGDCKKAISVLNKPVEMAMKLRVQYNDAQGEDKTAWESRLKGAENDRDGALSAATATILDMDKADVSDRTRECVEAVVERGKFRFEDKETFGEYMQVLQRANQAIFADQKKLLQRMKDAKKAYTAKKDSRVAEVAGA