Scaffold Ga0186532_1037397

Overview

Basic Information

• Taxon OID: 3300017278
• Scaffold ID: Ga0186532_1037397
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, no silicate, 15 C, 29.4 psu salinity and 386 ?mol photons light - Heterocapsa triquetra CCMP 448 (MMETSP0448)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 41.54
  • Long. (^o): -70.61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074355	Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186532_10373971	F074355	N/A	LKTTCGSSERRKCGTSAMRALHLPNRRRSQKYVTLDDVSLECSCMVNLTDTVESLKLKISSAKFCPVQNIHFTISGKEIPNSSALKDHFDMNTRFLLSWQSPIA