NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186313_132474

Scaffold Ga0186313_132474


Overview

Basic Information
Taxon OID3300017256 Open in IMG/M
Scaffold IDGa0186313_132474 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with seawater, no Na2SiO3, 25 C, 34 psu salinity and 324 ?mol photons light - Symbiodinium sp. CCMP 2430 (MMETSP1115)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)543
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-23.5Long. (o)152.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030772Metagenome / Metatranscriptome184Y

Sequences

Protein IDFamilyRBSSequence
Ga0186313_1324741F030772N/AWQRFLTHPFADFLSLPWEEFVLEHNRHHASTVDLLIQGEFGWDPEEFHYALQQWAGPWGSNWYKYLLTVPFIPVIHFFGLNDTGSLFALEWWMHFPDEGAGGKCNKEFWSKWVPRRVKHNAFVLGLWTCVWLLGTYPLGRPLSEGWRFMFAVSFFARVGYSAAWMFITNFTHSLPWNEFL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.