Scaffold Ga0186313_130151

Overview

Basic Information

• Taxon OID: 3300017256
• Scaffold ID: Ga0186313_130151
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with seawater, no Na2SiO3, 25 C, 34 psu salinity and 324 ?mol photons light - Symbiodinium sp. CCMP 2430 (MMETSP1115)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 610
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium natans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -23.5
  • Long. (^o): 152.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036711	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186313_1301511	F036711	N/A	DCLAFTSSGAMPVWQNVNLKQKAIFEIIQREETGDLPYYLNDEELDFFVRGLACGPHAKTYLPQLVERDKRPIYIARGYAPPTYSRVVKLRFYGPDPLMKDAGSSWPAGHEGELLEYIVGWRWLYAYWDGPLVDEVDEAWNTKQWPDIARSDWTWEGLRFVTPPYWVPEDGRPWRKARNEEVPIRVTKGKGRGKGAKGPAGNA