Scaffold Ga0186352_118682

Overview

Basic Information

• Taxon OID: 3300017224
• Scaffold ID: Ga0186352_118682
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Sea grown at 20 C, 30 psu salinity and 440 ?mol photons light - Ammonia sp. (MMETSP1384)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 859
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Sea
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091322	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186352_1186821	F091322	N/A	MAAAAAASKEFPRIISNNLLTKSAFLSYSRYLAFGFGYFYAFCKALYLQSYVETEDQKKFAQLREAEISVNTLRGVTFHGPQLWDPEYTELQMKFRDCYPDFYLHPNDEFVYQTTRGRQREQKVKEDMHSEAVAFLKEWKASEGKR