Scaffold Ga0186339_113755

Overview

Basic Information

• Taxon OID: 3300017210
• Scaffold ID: Ga0186339_113755
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 103 ?mol photons light - Favella ehrenbergii Fehren 1 (MMETSP0123)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 718
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: USA: northern Puget Sound, Washington
• Coordinates
  • Lat. (^o): 48.634
  • Long. (^o): -122.868
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019022	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186339_1137551	F019022	N/A	KIKARMVFHITNYMRETNVWMIRKMRWILWGTFSFIPIYRNVYWDFLGRRVAWKDSLRGETEAEKEAAAVADRADWGYTPRYEGKYDFSIKTKKQAEQTRE