 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300017200 Open in IMG/M |
| Scaffold ID | Ga0186117_104120 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from unknown location in JM medium, at 23 C, 0 psu salinity and 285 ?mol photons light - Cryptomonas curvata CCAP 979/52 (MMETSP1050) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1483 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041012 | Metagenome / Metatranscriptome | 160 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186117_1041201 | F041012 | N/A | MEDAGIIKLYDPSPIPCLYVAPVANMVGRVPLFPLYLAGNSTPTIPHRFSKHKGSGFPMGSADSAAADGRRGSNTYEVNTWLWLFGQGKPRLGGLTVEETALKKSAKREEQAKRSVETRRRRKAARSSSQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |