NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186616_112277

Scaffold Ga0186616_112277


Overview

Basic Information
Taxon OID3300017132 Open in IMG/M
Scaffold IDGa0186616_112277 Open in IMG/M
Source Dataset NameMetatranscriptome of marine bacterial communities from South Pacific Ocean in f/2 medium with natural seawater, no silicate, 21 C, 35 psu salinity and 418 ?mol photons light - Rhodopseudomonas sp. CCMP768 (MMETSP1091)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)683
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameSouth Pacific Ocean
CoordinatesLat. (o)-39.0Long. (o)-176.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096687Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0186616_1122771F096687N/AVHSPVVFVGGSQKKAAALYTQAGDYQKTARFYYKKAEDTYYQANNWASYDDWRRARDQWDYFYSRNR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.