Basic Information | |
---|---|
Taxon OID | 3300017070 Open in IMG/M |
Scaffold ID | Ga0186594_104482 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 478 ?mol photons light - Phaeocystis sp. CCMP2710 (MMETSP1162) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1185 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Prymnesium → Prymnesium polylepis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arabian Sea | |||||||
Coordinates | Lat. (o) | 23.5643 | Long. (o) | 58.853 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102330 | Metagenome / Metatranscriptome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186594_1044821 | F102330 | N/A | CLRPFGMMLRALALLVCLQGGTALRLRPALTQQCKTALVAGVCSAQLLVAPAFGLVGPTLSEAITELDASAYPIIKALPADTFPAFSEKIANLFLGFKPDKLAKSIDLGADLFNSVPQEDITAFNGVVTSAFAGLKPDSCELVPLPPPSLVTTFTGSEGYAQADASKIKAFNDKWGPTLAALPRTADGAKICLPSPENLDKLAFAQAKLAKGFGADEAKAFGTYFGGVSKASIVPGKVLPLLGEAQKQTMGADLKERQRFKAAGSALETISKTCAALPKKEQCQL |
⦗Top⦘ |