Basic Information | |
---|---|
Taxon OID | 3300016978 Open in IMG/M |
Scaffold ID | Ga0186394_104284 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in f/2 medium, 20 C, 36 psu salinity and 297 ?mol photons light - Pseudo-nitzschia arenysensis B593 (MMETSP0329) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2008 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 40.8083 | Long. (o) | 14.25 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045520 | Metagenome / Metatranscriptome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186394_1042842 | F045520 | GAG | MAFNRLYKHIESLIQTDDDVGDSIPCKADILSVRECRKGGKACDELGLDLLRCMAQFKVDETEKIRTSIGVAKYNEYVKEMEDKHGKEKAAEMINEPTEQLKDIEAYQVLHRIANDKHPKGPPKTKDDLMKWSYADQVRLEMGEGEWWDALKIIGYEFGLAKTDALFGLKKENDLINSAQTRLIPGFDEKKASAMSAAKKIEESVKEAAPGGKTASDFAAAFNDLYPTKADLDAAL |
⦗Top⦘ |