Scaffold Ga0186413_105552

Overview

Basic Information

• Taxon OID: 3300016849
• Scaffold ID: Ga0186413_105552
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Indian Ocean in L1 medium with seawater, 24 C, 33 psu salinity and 573 ?mol photons light - Bathycoccus prasinos RCC 716 (MMETSP1460)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 768
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Indian Ocean
• Coordinates
  • Lat. (^o): -14.483333
  • Long. (^o): 113.45
  • Depth (m): 70

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102591	Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186413_1055521	F102591	N/A	KGDFSSLLPHLNNNTHYLAHTFIPNSSFIIIMAPTTAQKLLAAYNGFYGVTLYHNWVTYYGPKGIMPYFLKTEGPVALMAWRMLGCLLLGITYGLLTAGPKDKTALKIATVGQAMMLPLMAMAGFGTDAATYAQTMWKTQLVVHAAMTYVGYSASQPTKTRSSSRRR