Scaffold Ga0186337_105748

Overview

Basic Information

• Taxon OID: 3300016796
• Scaffold ID: Ga0186337_105748
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean grown at 7 C, 34.25 psu salinity and 124 ?mol photons light - unclassified eukaryote Undescribed (MMETSP1317)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 589
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 120.06
  • Long. (^o): -34.175
  • Depth (m): 570

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092248	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186337_1057481	F092248	GGA	LLRLLLPLSDKVYLISRLGSRSSPKGSPDHSKSVGATGGVYKGQGL