NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186358_103875

Scaffold Ga0186358_103875


Overview

Basic Information
Taxon OID3300016768 Open in IMG/M
Scaffold IDGa0186358_103875 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from North Pacific Ocean in K/2 Ian medium, 22 C, 35 psu salinity and 347 ?mol photons light - unclassified eukaryote RCC 2335 (MMETSP1312)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1338
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameNorth Pacific Ocean
CoordinatesLat. (o)35.21666667Long. (o)139.6166667Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079415Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0186358_1038751F079415N/AGGCKTGVTRARIKRNETGSGATQTRASRRPRTRPSAPPRHKARPPTKRKMKSTALAVALAVALAVALAVATVSTCLAEKEESYFEAAYRFEATHFCETMTTNNKQCGWVGMDDPRYENDREVKINQIGCPMCGTEWGGWYEANEAGTGVSLRYPPNAIIGPGIRGAGYSQYFPRFLSLGCRGKKVEVQAVYKLIDAGEEQNGSGPYYAGLSLTDTPWYPKNLTRCSIGTGQEPSNTAADCRECQQSASGEGGCPIEKDTWYMDTMILDMPEQCPPSQDGPVMPSILVNAYQTLNVSAFTATPIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.