Scaffold Ga0182056_1253738

Overview

Basic Information

• Taxon OID: 3300016729
• Scaffold ID: Ga0182056_1253738
• Source Dataset Name: Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 608
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 31.972
  • Long. (^o): -81.028
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065835	Metagenome / Metatranscriptome	127	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182056_12537381	F065835	GGAG	MTDETMESMETNEGIKGLREKLKSVEQENKELKNVVKTSLFKDVGLDPHSGTGKMAFDLYDGKPDTAELGQWLKETYNIDTEVQQNNEVAAAKIAESDNKLTQIQQNSAAAQPADWTQKMQDVIASGDTSVRDSLRAKLAL